Connecting Odds
State Street

Senior Software Engineer - Java, Officer

State Street
Hyderabad, IndiaPosted 29 days agoDiscoveredMatch locked
Full time

Who we are looking for

Leading technical contributor to the enhancement and maintenance of one or more Charles River IMS modules or components of an agile scrum team. Provide engineering troubleshooting assistance to customer support teams and other development teams within Charles River.

Responsibilities

  • Drive technical excellence in architecting and developing Enterprise and Cloud-Native applications within the Charles River’s Front Office Order and Execution Management systems(OEMS) space.
  • Collaborate with Business Analysts and Product Managers to create simple and sustainable software solutions for complex problems.
  • Provide thought leadership in the design of product architecture within and beyond the team’s scope of responsibility.
  • Direct problem solving for projects or major phases of projects involving transactional database intensive applications with a high concurrency.
  • Design, Develop, Test, Debug, and Implement software programs, applications and projects using Java, C#, React, SQL, JavaScript, or other related software engineering languages as well as keeping abreast of emerging technologies impactful to CRDs business.
  • Provide informed guidance and critical analysis of proposed changes during code reviews.
  • Write unit and automation tests to ensure a high-quality product.
  • Contribute to written design and API documentation and participate in customer documentation process.
  • Identify ways of improving development test methodologies contribute to and related test methodology frameworks.
  • Develop automate test and conduct manual tests to ensure a high-quality product.
  • Provide expert level troubleshooting on large, mission critical client implementations.
  • Actively assist team leaders in the agile software development process by adhering to and advancing the CRD scrum methodology, including attending the scrum rituals(daily standups, sprint planning, backlog grooming, and retrospectives).
  • Drive Scrum rituals as required by the team lead and the team.
  • Plan and coordinate cross-team activities groups to complete assignments.
  • Mentor junior and senior engineers across the organization and help fast onboarding of new members on the team.

Experience

  • A minimum of 12 years of progressively responsible professional experience in a software engineering role including a minimum of 5 years in a Senior Engineer level capacity.
  • A minimum of 8 years in developing highly performant applications in Java programming language.
  • A minimum of 5 years of experience in designing and developing software solutions in a highly transactional ,concurrent, event driven system.
  • A minimum of 5 years’ cloud native application development experience in a cloud native platform(preferably, Microsoft Azure) and demonstrated experience in Spring Boot Microservices, Kafka /Azure Service Bus/RabbitMQ,, Kubernetes, Redis and cloud databases.
  • A minimum of 5 years working with an Agile development methodology.
  • Demonstrated experience with object-oriented programming, compiler or interpreter technologies, embedded systems, operating systems, scripting, and new/advanced programming languages.
  • Demonstrated experience in SQL Server and Postgres relational databases at the minimum and preferable experience in Oracle, Exadata. Experience in other DBMS like Cosmos, MongoDB, Snowflake etc is strongly desired.
  • Demonstrated experience in Observability, Telemetry using tools like Dynatrace, Solarwinds, Grafana, OpenTelemetry etc.
  • Experience in financial services domain developing solutions for Portfolio Management, Trading, Order Management,  Compliance, Post-Trade, IBOR or Wealth Management is strongly desired.
  • UI development experience in .Net/C#, React, JavaScript is strongly desired.
  • Outstanding written and verbal communication skills.
  • Ability to work well with peers in a collaborative team environment.
  • Ability to manage solution complexity to ensure simple designs and workflows.
  • Ability to coordinate and lead cross-team activities.

About Charles River Development

Charles River Investment management System in a platform that provides many Front-Office functions including Portfolio Management, Order Management and Execution, Compliance, Performance & Attribution, Modelling, Scenario Analysis, and Wealth Management. We are part of the State Street Bank. State Street is one of the largest custodian banks, asset managers, and asset intelligence companies in the world. From technology to product innovation, we’re making our mark in the financial services industry. For more than two centuries, we’ve been helping our clients safeguard and steward the investments of millions of people. We provide investment servicing, data & analytics, investment research & trading, and investment management to institutional clients.

Work, Live and Grow.

We make all efforts to create a great work environment. Our benefits packages are competitive and comprehensive. Details vary in location, but you may expect generous medical care, insurance and savings plans among other perks. You’ll have access to flexible Work Program to help you match your needs. And our wealth of development programs and educational support will help you reach your full potential.

Inclusion, Diversity and Social Responsibility.

We truly believe our employees’ diverse backgrounds, experiences and perspective are a powerful contributor to creating an inclusive environment where everyone can thrive and reach their maximum potential while adding value to both our organization and our clients. We warmly welcome candidates of diverse origin, background, ability, age, sexual orientation, gender identity and personality. Another fundamental value at State Street is active engagement with our communities around the world, both as a partner and a leader. You will have tools to help balance your professional and personal life, paid volunteer days, matching gift programs and access to employee networks that help you stay connected to what matters to you. State Street is an equal opportunity and affirmative action employer. Discover more at StateStreet.com/careers. Interested in learning more about us? Visit our

www.crd.com

LinkedIn page:

About State Street

Across the globe, institutional investors rely on us to help them manage risk, respond to challenges, and drive performance and profitability. We keep our clients at the heart of everything we do, and smart, engaged employees are essential to our continued success. We are committed to fostering an environment where every employee feels valued and empowered to reach their full potential. As an essential partner in our shared success, you’ll benefit from inclusive development opportunities, flexible work-life support, paid volunteer days, and vibrant employee networks that keep you connected to what matters most. Join us in shaping the future. As an Equal Opportunity Employer, we consider all qualified applicants for all positions without regard to race, creed, color, religion, national origin, ancestry, ethnicity, age, disability, genetic information, sex, sexual orientation, gender identity or expression, citizenship, marital status, domestic partnership or civil union status, familial status, military and veteran status, and other characteristics protected by applicable law. Discover more information on jobs at StateStreet.com/careers Read our CEO Statement

Not included in the source posting: benefits.

Skills

scrumagilejavaazurecjavascriptreactsqlgrafanakafkakubernetesmongodb

Who can apply

The employer didn't state any visa, work authorization, citizenship or clearance requirements in this posting. Confirm with the employer before applying.

Read automatically from the employer's posting text. Always confirm with the employer — requirements can change after a job is published.